Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (96 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [188915] (4 PDB entries) |
Domain d3hjna_: 3hjn A: [177613] automated match to d4tmka_ complexed with adp, mg, tyd |
PDB Entry: 3hjn (more details), 2.1 Å
SCOPe Domain Sequences for d3hjna_:
Sequence, based on SEQRES records: (download)
>d3hjna_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]} mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkae lflflasrnllvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdgl ipdltfyidvdvetalkrkgelnrfekreflervregylvlarehperivvldgkrsiee ihrdvvrevkrr
>d3hjna_ c.37.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]} mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkae lflflasrnllvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdgl ipdltfyidvdvetalkrknrfekreflervregylvlarehperivvldgkrsieeihr dvvrevkrr
Timeline for d3hjna_: