SCOPe 2.08: Domain d3hhua_: 3hhu A:

Lineage for d3hhua_ (3hhu A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (114 PDB entries)

8. Domain d3hhua_: 3hhu A: [177584]
   automated match to d1osfa_
   complexed with 819

Details for d3hhua_

PDB Entry: 3hhu, 1.59 Å

PDB Description: human heat-shock protein 90 (hsp90) in complex with {4-[3-(2,4- dihydroxy-5-isopropyl-phenyl)-5-thioxo- 1,5-dihydro-[1,2,4]triazol-4- yl]-benzyl}-carbamic acid ethyl ester {zk 2819}

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3hhua_:

Sequence; same for both SEQRES and ATOM records:

>d3hhua_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfve

Timeline for d3hhua_:

• d3hhua_ first appeared in SCOPe 2.01
  
• d3hhua_ appears in SCOPe 2.07