Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins) contains irregular array of helices in the N-terminal extension automatically mapped to Pfam PF02211 |
Protein automated matches [190606] (3 species) not a true protein |
Species Geobacillus pallidus [TaxId:33936] [188988] (1 PDB entry) |
Domain d3hhtb_: 3hht B: [177583] Other proteins in same PDB: d3hhta_ automated match to d1v29b_ complexed with 3co, cl; mutant |
PDB Entry: 3hht (more details), 1.16 Å
SCOPe Domain Sequences for d3hhtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hhtb_ b.34.4.4 (B:) automated matches {Geobacillus pallidus [TaxId: 33936]} mngihdvggmdgfgkvmyvkeeediyfthdwerlalglvagcmaqglgmkafdefrigie lmrpvdyltssyyghwiatvaynlvdtgvldekeldertevfskkpdtkiprredpalvk lvekalndglsplreisasprfkvgeriktknihptghtrfpryardkygvidevygahv fpddaahrkgenpqylyrvrfeaeelwgykqkdsvyidlwesymepv
Timeline for d3hhtb_: