![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (14 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries) |
![]() | Domain d3hfaj_: 3hfa J: [177511] automated match to d1q5qh_ complexed with dmf; mutant |
PDB Entry: 3hfa (more details), 2.5 Å
SCOPe Domain Sequences for d3hfaj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hfaj_ d.153.1.4 (J:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
Timeline for d3hfaj_:
![]() Domains from other chains: (mouse over for more information) d3hfa1_, d3hfa2_, d3hfaa_, d3hfab_, d3hfac_, d3hfad_, d3hfae_, d3hfaf_, d3hfag_, d3hfah_, d3hfai_, d3hfak_, d3hfal_, d3hfam_, d3hfan_, d3hfao_, d3hfap_, d3hfaq_, d3hfar_, d3hfas_, d3hfat_, d3hfau_, d3hfav_, d3hfaw_, d3hfax_, d3hfay_, d3hfaz_ |