Lineage for d3hfa1_ (3hfa 1:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045650Protein automated matches [190144] (6 species)
    not a true protein
  7. 1045758Species Mycobacterium tuberculosis [TaxId:1773] [187707] (9 PDB entries)
  8. 1045787Domain d3hfa1_: 3hfa 1: [177500]
    automated match to d1q5qa_
    complexed with dmf; mutant

Details for d3hfa1_

PDB Entry: 3hfa (more details), 2.5 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome open-gate mutant
PDB Compounds: (1:) Proteasome (Alpha subunit) PrcA

SCOPe Domain Sequences for d3hfa1_:

Sequence, based on SEQRES records: (download)

>d3hfa1_ d.153.1.4 (1:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
ragsadtsggdqptlgvaslevavldanrprrafrritgsalqall

Sequence, based on observed residues (ATOM records): (download)

>d3hfa1_ d.153.1.4 (1:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
meqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf
nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva
hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal
ralgvaslevavldanrprrafrritgsalqall

SCOPe Domain Coordinates for d3hfa1_:

Click to download the PDB-style file with coordinates for d3hfa1_.
(The format of our PDB-style files is described here.)

Timeline for d3hfa1_: