![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (14 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [187707] (14 PDB entries) |
![]() | Domain d3hf9w_: 3hf9 W: [177496] automated match to d1q5qa_ mutant |
PDB Entry: 3hf9 (more details), 2.88 Å
SCOPe Domain Sequences for d3hf9w_:
Sequence, based on SEQRES records: (download)
>d3hf9w_ d.153.1.4 (W:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} aksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfnefdnlrrggiqfadtrg yaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevahygetkrpelyritydgs iadephfvvmggttepianalkesyaenasltdalriavaalragsadtsggdqptlgva slevavldanrprrafrritgsalqal
>d3hf9w_ d.153.1.4 (W:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} aksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkfnefdnlrrggiqfadtrg yaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaevahygetkrpelyritydgs iadephfvvmggttepianalkesyaenasltdalriavaalravaslevavldanrprr afrritgsalqal
Timeline for d3hf9w_:
![]() Domains from other chains: (mouse over for more information) d3hf91_, d3hf92_, d3hf93_, d3hf94_, d3hf9a_, d3hf9b_, d3hf9c_, d3hf9d_, d3hf9e_, d3hf9f_, d3hf9g_, d3hf9h_, d3hf9i_, d3hf9j_, d3hf9k_, d3hf9l_, d3hf9m_, d3hf9n_, d3hf9o_, d3hf9p_, d3hf9q_, d3hf9r_, d3hf9s_, d3hf9t_, d3hf9u_, d3hf9v_, d3hf9x_, d3hf9y_, d3hf9z_ |