Lineage for d1hqoa1 (1hqo A:201-354)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443787Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species)
    similar to class phi enzymes
  7. 443788Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (8 PDB entries)
  8. 443797Domain d1hqoa1: 1hqo A:201-354 [17749]
    Other proteins in same PDB: d1hqoa2, d1hqob2

Details for d1hqoa1

PDB Entry: 1hqo (more details), 2.3 Å

PDB Description: crystal structure of the nitrogen regulation fragment of the yeast prion protein ure2p

SCOP Domain Sequences for d1hqoa1:

Sequence, based on SEQRES records: (download)

>d1hqoa1 a.45.1.1 (A:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv
driginikiefpevykwtkhmmrrpavikalrge

Sequence, based on observed residues (ATOM records): (download)

>d1hqoa1 a.45.1.1 (A:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmfdypvwlvgdkltiadlafvpwnnvvdriginikiefpevykwtkhmm
rrpavikalrge

SCOP Domain Coordinates for d1hqoa1:

Click to download the PDB-style file with coordinates for d1hqoa1.
(The format of our PDB-style files is described here.)

Timeline for d1hqoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hqoa2