SCOP 1.71: Domain d1f2ed1: 1f2e D:81-201

Lineage for d1f2ed1 (1f2e D:81-201)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class beta GST [81357] (3 species)

7. Species Sphingomonas paucimobilis [TaxId:13689] [47640] (1 PDB entry)

8. Domain d1f2ed1: 1f2e D:81-201 [17748]
   Other proteins in same PDB: d1f2ea2, d1f2eb2, d1f2ec2, d1f2ed2
   complexed with gtt

Details for d1f2ed1

PDB Entry: 1f2e, 2.3 Å

PDB Description: structure of sphingomonad, glutathione s-transferase complexed with glutathione

SCOP Domain Sequences for d1f2ed1:

Sequence; same for both SEQRES and ATOM records:

>d1f2ed1 a.45.1.1 (D:81-201) Class beta GST {Sphingomonas paucimobilis}
glapaegsldryrllsrlsflgsefhkafvplfapatsdeakaaaaesvknhlaaldkel
agrdhyagnafsvadiylyvmlgwpayvgidmaaypalgayagkiaqrpavgaalkaegl
a

Timeline for d1f2ed1:

• d1f2ed1 first appeared (with stable ids) in SCOP 1.55
  
• d1f2ed1 appears in SCOP 1.69
  
• d1f2ed1 appears in SCOP 1.73
  
• d1f2ed1 appears in the current release, SCOPe 2.08