SCOP 1.75: Domain d1f2ec1: 1f2e C:81-201

Lineage for d1f2ec1 (1f2e C:81-201)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class beta GST [81357] (3 species)

7. Species Sphingomonas paucimobilis [TaxId:13689] [47640] (1 PDB entry)

8. Domain d1f2ec1: 1f2e C:81-201 [17747]
   Other proteins in same PDB: d1f2ea2, d1f2eb2, d1f2ec2, d1f2ed2

Details for d1f2ec1

PDB Entry: 1f2e, 2.3 Å

PDB Description: structure of sphingomonad, glutathione s-transferase complexed with glutathione

PDB Compounds: (C:) glutathione s-transferase

SCOP Domain Sequences for d1f2ec1:

Sequence; same for both SEQRES and ATOM records:

>d1f2ec1 a.45.1.1 (C:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]}
glapaegsldryrllsrlsflgsefhkafvplfapatsdeakaaaaesvknhlaaldkel
agrdhyagnafsvadiylyvmlgwpayvgidmaaypalgayagkiaqrpavgaalkaegl
a

Timeline for d1f2ec1:

• d1f2ec1 first appeared (with stable ids) in SCOP 1.55
  
• d1f2ec1 appears in SCOP 1.73
  
• d1f2ec1 appears in SCOPe 2.01
  
• d1f2ec1 appears in the current release, SCOPe 2.08