SCOPe 2.06: Domain d3hf4f_: 3hf4 F:

Lineage for d3hf4f_ (3hf4 F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188924] (2 PDB entries)

8. Domain d3hf4f_: 3hf4 F: [177463]
   automated match to d1jebd_
   complexed with hem

Details for d3hf4f_

PDB Entry: 3hf4, 2.7 Å

PDB Description: crystal structure of rat methemoglobin in r2 state

PDB Compounds: (F:) Hemoglobin subunit beta-1

SCOPe Domain Sequences for d3hf4f_:

Sequence; same for both SEQRES and ATOM records:

>d3hf4f_ a.1.1.2 (F:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vhltdaekaavnglwgkvnpddvggealgrllvvypwtqryfdsfgdlssasaimgnpkv
kahgkkvinafndglkhldnlkgtfahlselhcdklhvdpenfrllgnmivivlghhlgk
eftpcaqaafqkvvagvasalahkyh

Timeline for d3hf4f_:

• d3hf4f_ first appeared in SCOPe 2.01
  
• d3hf4f_ appears in SCOPe 2.05
  
• d3hf4f_ appears in SCOPe 2.07
  
• d3hf4f_ appears in the current release, SCOPe 2.08