Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class beta GST [81357] (4 species) |
Species Sphingomonas paucimobilis [TaxId:13689] [47640] (1 PDB entry) |
Domain d1f2eb1: 1f2e B:81-201 [17746] Other proteins in same PDB: d1f2ea2, d1f2eb2, d1f2ec2, d1f2ed2 complexed with gsh |
PDB Entry: 1f2e (more details), 2.3 Å
SCOPe Domain Sequences for d1f2eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f2eb1 a.45.1.1 (B:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} glapaegsldryrllsrlsflgsefhkafvplfapatsdeakaaaaesvknhlaaldkel agrdhyagnafsvadiylyvmlgwpayvgidmaaypalgayagkiaqrpavgaalkaegl a
Timeline for d1f2eb1: