SCOPe 2.08: Domain d3hekb1: 3hek B:9-225

Lineage for d3hekb1 (3hek B:9-225)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (114 PDB entries)

8. Domain d3hekb1: 3hek B:9-225 [177451]
   Other proteins in same PDB: d3heka2, d3hekb2
   automated match to d1osfa_
   complexed with bd0, po4

Details for d3hekb1

PDB Entry: 3hek, 1.95 Å

PDB Description: hsp90 n-terminal domain in complex with 1-{4-[(2r)-1-(5-chloro-2,4- dihydroxybenzoyl)pyrrolidin-2-yl]benzyl}-3,3-difluoropyrrolidinium

PDB Compounds: (B:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3hekb1:

Sequence; same for both SEQRES and ATOM records:

>d3hekb1 d.122.1.1 (B:9-225) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
hlkedqteyleerrikeivkkhsqfigypitlfveke

Timeline for d3hekb1:

• d3hekb1 first appeared in SCOPe 2.01, called d3hekb_
  
• d3hekb1 appears in SCOPe 2.07