Lineage for d1f2ea1 (1f2e A:81-201)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443491Protein Class beta GST [81357] (3 species)
  7. 443504Species Sphingomonas paucimobilis [TaxId:13689] [47640] (1 PDB entry)
  8. 443505Domain d1f2ea1: 1f2e A:81-201 [17745]
    Other proteins in same PDB: d1f2ea2, d1f2eb2, d1f2ec2, d1f2ed2

Details for d1f2ea1

PDB Entry: 1f2e (more details), 2.3 Å

PDB Description: structure of sphingomonad, glutathione s-transferase complexed with glutathione
PDB Compounds: (A:)

SCOP Domain Sequences for d1f2ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis}
glapaegsldryrllsrlsflgsefhkafvplfapatsdeakaaaaesvknhlaaldkel
agrdhyagnafsvadiylyvmlgwpayvgidmaaypalgayagkiaqrpavgaalkaegl
a

SCOP Domain Coordinates for d1f2ea1:

Click to download the PDB-style file with coordinates for d1f2ea1.
(The format of our PDB-style files is described here.)

Timeline for d1f2ea1: