SCOPe 2.04: Domain d2pmtd1: 2pmt D:81-201

Lineage for d2pmtd1 (2pmt D:81-201)

Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
Protein Class beta GST [81357] (4 species)
Species Proteus mirabilis [TaxId:584] [47639] (2 PDB entries)
Domain d2pmtd1: 2pmt D:81-201 [17744]
Other proteins in same PDB: d2pmta2, d2pmtb2, d2pmtc2, d2pmtd2
complexed with gsh

Details for d2pmtd1

PDB Entry: 2pmt (more details), 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis

PDB Compounds: (D:) glutathione transferase

SCOPe Domain Sequences for d2pmtd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmtd1 a.45.1.1 (D:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]}
nliappkaleryhqiewlnflasevhkgysplfssdtpesylpvvknklkskfvyindvl
skqkcvcgdhftvadaylftlsqwaphvaldltdlshlqdylariaqrpnvhsalvtegl
i

SCOPe Domain Coordinates for d2pmtd1:

Click to download the PDB-style file with coordinates for d2pmtd1.
(The format of our PDB-style files is described here.)

Timeline for d2pmtd1: