Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries) |
Domain d3heid1: 3hei D:18-147 [177433] Other proteins in same PDB: d3heia_, d3heib2, d3heic_, d3heid2, d3heie_, d3heif2, d3heig_, d3heih2, d3heii_, d3heij2, d3heik_, d3heil2, d3heim_, d3hein2, d3heio_, d3heip2 automated match to d1shwa_ |
PDB Entry: 3hei (more details), 2 Å
SCOPe Domain Sequences for d3heid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3heid1 b.6.1.0 (D:18-147) automated matches {Human (Homo sapiens) [TaxId: 9606]} adrhtvfwnssnpkfrnedytihvqlndyvdiicphyedhsvadaameqyilylveheey qlcqpqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhe drclrlkvtv
Timeline for d3heid1: