Lineage for d2pmtc1 (2pmt C:81-201)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153293Species Proteus mirabilis [TaxId:584] [47639] (2 PDB entries)
  8. 153297Domain d2pmtc1: 2pmt C:81-201 [17743]
    Other proteins in same PDB: d2pmta2, d2pmtb2, d2pmtc2, d2pmtd2

Details for d2pmtc1

PDB Entry: 2pmt (more details), 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis

SCOP Domain Sequences for d2pmtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmtc1 a.45.1.1 (C:81-201) Glutathione S-transferase {Proteus mirabilis}
nliappkaleryhqiewlnflasevhkgysplfssdtpesylpvvknklkskfvyindvl
skqkcvcgdhftvadaylftlsqwaphvaldltdlshlqdylariaqrpnvhsalvtegl
i

SCOP Domain Coordinates for d2pmtc1:

Click to download the PDB-style file with coordinates for d2pmtc1.
(The format of our PDB-style files is described here.)

Timeline for d2pmtc1: