SCOPe 2.04: Domain d3hebb_: 3heb B:

Lineage for d3hebb_ (3heb B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (54 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:269796] [188910] (1 PDB entry)

8. Domain d3hebb_: 3heb B: [177427]
   automated match to d1k68a_
   complexed with po4

Details for d3hebb_

PDB Entry: 3heb, 2.4 Å

PDB Description: crystal structure of response regulator receiver domain from rhodospirillum rubrum

PDB Compounds: (B:) Response regulator receiver domain protein (CheY)

SCOPe Domain Sequences for d3hebb_:

Sequence; same for both SEQRES and ATOM records:

>d3hebb_ c.23.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
vtivmieddlgharlieknirragvnneiiaftdgtsalnylfgddksgrvsagraqlvl
ldlnlpdmtgidilklvkenphtrrspvviltttddqreiqrcydlganvyitkpvnyen
fanairqlglffsvmqvpeteg

Timeline for d3hebb_:

• d3hebb_ first appeared in SCOPe 2.01
  
• d3hebb_ appears in SCOPe 2.03
  
• d3hebb_ appears in SCOPe 2.05
  
• d3hebb_ appears in the current release, SCOPe 2.08, called d3hebb1