SCOPe 2.04: Domain d2pmtb1: 2pmt B:81-201

Lineage for d2pmtb1 (2pmt B:81-201)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class beta GST [81357] (4 species)

7. Species Proteus mirabilis [TaxId:584] [47639] (2 PDB entries)

8. Domain d2pmtb1: 2pmt B:81-201 [17742]
   Other proteins in same PDB: d2pmta2, d2pmtb2, d2pmtc2, d2pmtd2
   complexed with gsh

Details for d2pmtb1

PDB Entry: 2pmt, 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis

PDB Compounds: (B:) glutathione transferase

SCOPe Domain Sequences for d2pmtb1:

Sequence; same for both SEQRES and ATOM records:

>d2pmtb1 a.45.1.1 (B:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]}
nliappkaleryhqiewlnflasevhkgysplfssdtpesylpvvknklkskfvyindvl
skqkcvcgdhftvadaylftlsqwaphvaldltdlshlqdylariaqrpnvhsalvtegl
i

Timeline for d2pmtb1:

• d2pmtb1 first appeared (with stable ids) in SCOP 1.55
  
• d2pmtb1 appears in SCOPe 2.03
  
• d2pmtb1 appears in SCOPe 2.05
  
• d2pmtb1 appears in the current release, SCOPe 2.08