SCOPe 2.06: Domain d3hdza_: 3hdz A:

Lineage for d3hdza_ (3hdz A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein automated matches [190370] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)

8. Domain d3hdza_: 3hdz A: [177417]
   automated match to d1t9sa_
   complexed with mg, pd6, zn

Details for d3hdza_

PDB Entry: 3hdz, 1.8 Å

PDB Description: identification, synthesis, and sar of amino substituted pyrido[3, 2b]pryaziones as potent and selective pde5 inhibitors

PDB Compounds: (A:) cGMP-specific 3',5'-cyclic phosphodiesterase, cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d3hdza_:

Sequence; same for both SEQRES and ATOM records:

>d3hdza_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
hpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlki
ikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpiq
qriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthv
sedcfplldgcrknrqkwqalae

Timeline for d3hdza_:

• d3hdza_ first appeared in SCOPe 2.01
  
• d3hdza_ appears in SCOPe 2.05
  
• d3hdza_ appears in SCOPe 2.07
  
• d3hdza_ appears in the current release, SCOPe 2.08