Lineage for d3hdvd_ (3hdv D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856078Species Pseudomonas putida [TaxId:160488] [188909] (1 PDB entry)
  8. 2856082Domain d3hdvd_: 3hdv D: [177416]
    Other proteins in same PDB: d3hdvb2
    automated match to d1d5wa_

Details for d3hdvd_

PDB Entry: 3hdv (more details), 2.09 Å

PDB Description: crystal structure of response regulator receiver protein from pseudomonas putida
PDB Compounds: (D:) Response regulator

SCOPe Domain Sequences for d3hdvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdvd_ c.23.1.0 (D:) automated matches {Pseudomonas putida [TaxId: 160488]}
plvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlrmqpesg
ldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelvnke

SCOPe Domain Coordinates for d3hdvd_:

Click to download the PDB-style file with coordinates for d3hdvd_.
(The format of our PDB-style files is described here.)

Timeline for d3hdvd_: