Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (59 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [188909] (1 PDB entry) |
Domain d3hdvb_: 3hdv B: [177414] automated match to d1d5wa_ |
PDB Entry: 3hdv (more details), 2.09 Å
SCOPe Domain Sequences for d3hdvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdvb_ c.23.1.0 (B:) automated matches {Pseudomonas putida [TaxId: 160488]} slvaarplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlr mqpesgldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelv nkelki
Timeline for d3hdvb_: