Lineage for d2pmta1 (2pmt A:81-201)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641765Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 641766Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 641767Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 641882Protein Class beta GST [81357] (3 species)
  7. 641889Species Proteus mirabilis [TaxId:584] [47639] (2 PDB entries)
  8. 641891Domain d2pmta1: 2pmt A:81-201 [17741]
    Other proteins in same PDB: d2pmta2, d2pmtb2, d2pmtc2, d2pmtd2

Details for d2pmta1

PDB Entry: 2pmt (more details), 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis
PDB Compounds: (A:) glutathione transferase

SCOP Domain Sequences for d2pmta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]}
nliappkaleryhqiewlnflasevhkgysplfssdtpesylpvvknklkskfvyindvl
skqkcvcgdhftvadaylftlsqwaphvaldltdlshlqdylariaqrpnvhsalvtegl
i

SCOP Domain Coordinates for d2pmta1:

Click to download the PDB-style file with coordinates for d2pmta1.
(The format of our PDB-style files is described here.)

Timeline for d2pmta1: