Lineage for d3hdla_ (3hdl A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919407Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 919408Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 919873Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 919874Protein automated matches [191104] (2 species)
    not a true protein
  7. 919875Species Roystonea regia [TaxId:145709] [189129] (1 PDB entry)
  8. 919876Domain d3hdla_: 3hdl A: [177408]
    automated match to d1scha_
    complexed with ca, edo, hem, mes, nag, peo, so4, xyz

Details for d3hdla_

PDB Entry: 3hdl (more details), 1.85 Å

PDB Description: crystal structure of highly glycosylated peroxidase from royal palm tree
PDB Compounds: (A:) Royal Palm Tree Peroxidase

SCOPe Domain Sequences for d3hdla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdla_ a.93.1.0 (A:) automated matches {Roystonea regia [TaxId: 145709]}
dlqigfyntscptaeslvqqavaaafannsgiapglirmhfhdcfvrgcdasvlldstan
ntaekdaipnnpslrgfevitaaksaveaacpqtvscadilafaardsanlagnityqvp
sgrrdgtvslaseanaqipsplfnatqlinsfanktltademvtlsgahsigvahcssft
nrlynfnsgsgidptlspsyaallrntcpanstrftpitvsldiitpsvldnmyytgvql
tlglltsdqalvteanlsaavkanamnltawaskfaqamvkmgqievltgtqgeirtncs
vvns

SCOPe Domain Coordinates for d3hdla_:

Click to download the PDB-style file with coordinates for d3hdla_.
(The format of our PDB-style files is described here.)

Timeline for d3hdla_: