SCOPe 2.04: Domain d3hdge_: 3hdg E:

Lineage for d3hdge_ (3hdg E:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (54 species)
   not a true protein

7. Species Wolinella succinogenes [TaxId:844] [188908] (1 PDB entry)

8. Domain d3hdge_: 3hdg E: [177407]
   automated match to d1p6qa_
   complexed with mg

Details for d3hdge_

PDB Entry: 3hdg, 2.27 Å

PDB Description: crystal structure of the n-terminal domain of an uncharacterized protein (ws1339) from wolinella succinogenes

PDB Compounds: (E:) Uncharacterized protein

SCOPe Domain Sequences for d3hdge_:

Sequence; same for both SEQRES and ATOM records:

>d3hdge_ c.23.1.0 (E:) automated matches {Wolinella succinogenes [TaxId: 844]}
alkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklgg
lemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhik
lake

Timeline for d3hdge_:

• d3hdge_ first appeared in SCOPe 2.01
  
• d3hdge_ appears in SCOPe 2.03
  
• d3hdge_ appears in SCOPe 2.05
  
• d3hdge_ appears in the current release, SCOPe 2.08, called d3hdge1