Lineage for d3hdgd_ (3hdg D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1587002Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1587003Protein automated matches [190131] (54 species)
    not a true protein
  7. 1587225Species Wolinella succinogenes [TaxId:844] [188908] (1 PDB entry)
  8. 1587228Domain d3hdgd_: 3hdg D: [177406]
    automated match to d1p6qa_
    complexed with mg

Details for d3hdgd_

PDB Entry: 3hdg (more details), 2.27 Å

PDB Description: crystal structure of the n-terminal domain of an uncharacterized protein (ws1339) from wolinella succinogenes
PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d3hdgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdgd_ c.23.1.0 (D:) automated matches {Wolinella succinogenes [TaxId: 844]}
alkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklgg
lemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhik
lake

SCOPe Domain Coordinates for d3hdgd_:

Click to download the PDB-style file with coordinates for d3hdgd_.
(The format of our PDB-style files is described here.)

Timeline for d3hdgd_: