Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (54 species) not a true protein |
Species Wolinella succinogenes [TaxId:844] [188908] (1 PDB entry) |
Domain d3hdgd_: 3hdg D: [177406] automated match to d1p6qa_ complexed with mg |
PDB Entry: 3hdg (more details), 2.27 Å
SCOPe Domain Sequences for d3hdgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdgd_ c.23.1.0 (D:) automated matches {Wolinella succinogenes [TaxId: 844]} alkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklgg lemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhik lake
Timeline for d3hdgd_: