Lineage for d3hdgb_ (3hdg B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838317Species Wolinella succinogenes [TaxId:844] [188908] (1 PDB entry)
  8. 1838319Domain d3hdgb_: 3hdg B: [177405]
    automated match to d1p6qa_
    complexed with mg

Details for d3hdgb_

PDB Entry: 3hdg (more details), 2.27 Å

PDB Description: crystal structure of the n-terminal domain of an uncharacterized protein (ws1339) from wolinella succinogenes
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d3hdgb_:

Sequence, based on SEQRES records: (download)

>d3hdgb_ c.23.1.0 (B:) automated matches {Wolinella succinogenes [TaxId: 844]}
valkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklg
glemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhi
klake

Sequence, based on observed residues (ATOM records): (download)

>d3hdgb_ c.23.1.0 (B:) automated matches {Wolinella succinogenes [TaxId: 844]}
valkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklg
glemldrikaggakpyvivissemkyfikaielgvhlflpkpiepgrlmetledfrhikl
ake

SCOPe Domain Coordinates for d3hdgb_:

Click to download the PDB-style file with coordinates for d3hdgb_.
(The format of our PDB-style files is described here.)

Timeline for d3hdgb_: