Lineage for d3hcud_ (3hcu D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2183823Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2184040Protein automated matches [190124] (12 species)
    not a true protein
  7. 2184055Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)
  8. 2184122Domain d3hcud_: 3hcu D: [177396]
    automated match to d1j7db_
    protein/DNA complex; complexed with zn

Details for d3hcud_

PDB Entry: 3hcu (more details), 2.6 Å

PDB Description: crystal structure of traf6 in complex with ubc13 in the c2 space group
PDB Compounds: (D:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d3hcud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hcud_ d.20.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamn

SCOPe Domain Coordinates for d3hcud_:

Click to download the PDB-style file with coordinates for d3hcud_.
(The format of our PDB-style files is described here.)

Timeline for d3hcud_: