SCOP 1.67: Domain d1b8xa1: 1b8x A:81-260

Lineage for d1b8xa1 (1b8x A:81-260)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class beta GST [81357] (3 species)

7. Species Escherichia coli [TaxId:562] [47638] (3 PDB entries)

8. Domain d1b8xa1: 1b8x A:81-260 [17739]
   Other proteins in same PDB: d1b8xa2
   fused with nuclear matrix targeting signal of transcription factor AML-1

Details for d1b8xa1

PDB Entry: 1b8x, 2.7 Å

PDB Description: glutathione s-transferase fused with the nuclear matrix targeting signal of the transcription factor aml-1

SCOP Domain Sequences for d1b8xa1:

Sequence; same for both SEQRES and ATOM records:

>d1b8xa1 a.45.1.1 (A:81-260) Class beta GST {Escherichia coli}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhppksdlvprgsrrasvgsrmhypgaftysptpvtsgigigmsamgs

Timeline for d1b8xa1:

• d1b8xa1 first appeared (with stable ids) in SCOP 1.55
  
• d1b8xa1 appears in SCOP 1.65
  
• d1b8xa1 appears in SCOP 1.69
  
• d1b8xa1 appears in the current release, SCOPe 2.08