Lineage for d1b8xa1 (1b8x A:81-260)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153088Species Escherichia coli [TaxId:562] [47638] (2 PDB entries)
  8. 153091Domain d1b8xa1: 1b8x A:81-260 [17739]
    Other proteins in same PDB: d1b8xa2

Details for d1b8xa1

PDB Entry: 1b8x (more details), 2.7 Å

PDB Description: glutathione s-transferase fused with the nuclear matrix targeting signal of the transcription factor aml-1

SCOP Domain Sequences for d1b8xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8xa1 a.45.1.1 (A:81-260) Glutathione S-transferase {Escherichia coli}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhppksdlvprgsrrasvgsrmhypgaftysptpvtsgigigmsamgs

SCOP Domain Coordinates for d1b8xa1:

Click to download the PDB-style file with coordinates for d1b8xa1.
(The format of our PDB-style files is described here.)

Timeline for d1b8xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8xa2