SCOP 1.75: Domain d1a0fb1: 1a0f B:81-201

Lineage for d1a0fb1 (1a0f B:81-201)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class beta GST [81357] (3 species)

7. Species Escherichia coli [TaxId:562] [47638] (3 PDB entries)

8. Domain d1a0fb1: 1a0f B:81-201 [17738]
   Other proteins in same PDB: d1a0fa2, d1a0fb2
   complexed with gts

Details for d1a0fb1

PDB Entry: 1a0f, 2.1 Å

PDB Description: crystal structure of glutathione s-transferase from escherichia coli complexed with glutathionesulfonic acid

PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d1a0fb1:

Sequence; same for both SEQRES and ATOM records:

>d1a0fb1 a.45.1.1 (B:81-201) Class beta GST {Escherichia coli [TaxId: 562]}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqlekklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl
k

Timeline for d1a0fb1:

• d1a0fb1 first appeared (with stable ids) in SCOP 1.55
  
• d1a0fb1 appears in SCOP 1.73
  
• d1a0fb1 appears in SCOPe 2.01
  
• d1a0fb1 appears in the current release, SCOPe 2.08