Lineage for d1a0fb1 (1a0f B:81-201)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153088Species Escherichia coli [TaxId:562] [47638] (2 PDB entries)
  8. 153090Domain d1a0fb1: 1a0f B:81-201 [17738]
    Other proteins in same PDB: d1a0fa2, d1a0fb2

Details for d1a0fb1

PDB Entry: 1a0f (more details), 2.1 Å

PDB Description: crystal structure of glutathione s-transferase from escherichia coli complexed with glutathionesulfonic acid

SCOP Domain Sequences for d1a0fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0fb1 a.45.1.1 (B:81-201) Glutathione S-transferase {Escherichia coli}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqlekklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl
k

SCOP Domain Coordinates for d1a0fb1:

Click to download the PDB-style file with coordinates for d1a0fb1.
(The format of our PDB-style files is described here.)

Timeline for d1a0fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0fb2