Lineage for d3hceb_ (3hce B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145542Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
    automatically mapped to Pfam PF01234
  6. 2145564Protein automated matches [190168] (1 species)
    not a true protein
  7. 2145565Species Human (Homo sapiens) [TaxId:9606] [186895] (33 PDB entries)
  8. 2145627Domain d3hceb_: 3hce B: [177375]
    automated match to d1hnnb_
    complexed with otr, sah

Details for d3hceb_

PDB Entry: 3hce (more details), 2.85 Å

PDB Description: crystal structure of e185d hpnmt in complex with octopamine and adohcy
PDB Compounds: (B:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d3hceb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hceb_ c.66.1.15 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcldavspdlas
fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
rtyimpahlqtgvddvkgvffawaqkvg

SCOPe Domain Coordinates for d3hceb_:

Click to download the PDB-style file with coordinates for d3hceb_.
(The format of our PDB-style files is described here.)

Timeline for d3hceb_: