Lineage for d1aw9_1 (1aw9 83-217)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153255Species Maize (Zea mays), type III [TaxId:4577] [47637] (1 PDB entry)
  8. 153256Domain d1aw9_1: 1aw9 83-217 [17736]
    Other proteins in same PDB: d1aw9_2

Details for d1aw9_1

PDB Entry: 1aw9 (more details), 2.2 Å

PDB Description: structure of glutathione s-transferase iii in apo form

SCOP Domain Sequences for d1aw9_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw9_1 a.45.1.1 (83-217) Glutathione S-transferase {Maize (Zea mays), type III}
gtdllpatasaaklevwleveshhfypnasplvfqllvrpllggapdaavvdkhaeqlak
vldvyeahlarnkylagdeftladanhasyllylsktpkaglvaarphvkawweaivarp
afqktvaaiplpppp

SCOP Domain Coordinates for d1aw9_1:

Click to download the PDB-style file with coordinates for d1aw9_1.
(The format of our PDB-style files is described here.)

Timeline for d1aw9_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aw9_2