SCOPe 2.01: Domain d3hbex_: 3hbe X:

Lineage for d3hbex_ (3hbe X:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (6 species)
   not a true protein

7. Species Picea abies [TaxId:3329] [188984] (3 PDB entries)

8. Domain d3hbex_: 3hbe X: [177359]
   automated match to d1dxja_
   complexed with act, for, mxe

Details for d3hbex_

PDB Entry: 3hbe, 1.55 Å

PDB Description: Class IV chitinase structure from Picea abies at 1.55A

PDB Compounds: (X:) Class IV chitinase Chia4-Pa2

SCOPe Domain Sequences for d3hbex_:

Sequence; same for both SEQRES and ATOM records:

>d3hbex_ d.2.1.0 (X:) automated matches {Picea abies [TaxId: 3329]}
svggiisqsffnglaggaasscegkgfytynafiaaanaysgfgttgsndvkkrelaaff
anvmhetgglcyineknppinycqssstwpctsgksyhgrgplqlswnynygaagksigf
dglnnpekvgqdstisfktavwfwmknsnchsaitsgqgfggtikainsmecnggnsgev
ssrvnyykkicsqlgvdpganvsc

Timeline for d3hbex_:

• d3hbex_ is new in SCOPe 2.01-stable
  
• d3hbex_ appears in SCOPe 2.02
  
• d3hbex_ appears in the current release, SCOPe 2.08