Lineage for d3hbex_ (3hbe X:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014821Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1014822Protein automated matches [190563] (6 species)
    not a true protein
  7. 1014835Species Picea abies [TaxId:3329] [188984] (3 PDB entries)
  8. 1014836Domain d3hbex_: 3hbe X: [177359]
    automated match to d1dxja_
    complexed with act, for, mxe

Details for d3hbex_

PDB Entry: 3hbe (more details), 1.55 Å

PDB Description: Class IV chitinase structure from Picea abies at 1.55A
PDB Compounds: (X:) Class IV chitinase Chia4-Pa2

SCOPe Domain Sequences for d3hbex_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hbex_ d.2.1.0 (X:) automated matches {Picea abies [TaxId: 3329]}
svggiisqsffnglaggaasscegkgfytynafiaaanaysgfgttgsndvkkrelaaff
anvmhetgglcyineknppinycqssstwpctsgksyhgrgplqlswnynygaagksigf
dglnnpekvgqdstisfktavwfwmknsnchsaitsgqgfggtikainsmecnggnsgev
ssrvnyykkicsqlgvdpganvsc

SCOPe Domain Coordinates for d3hbex_:

Click to download the PDB-style file with coordinates for d3hbex_.
(The format of our PDB-style files is described here.)

Timeline for d3hbex_: