Lineage for d3hb3d_ (3hb3 D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein automated matches [190119] (23 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. Domain d3hb3d_: 3hb3 D: [177356]
    Other proteins in same PDB: d3hb3a_, d3hb3b1, d3hb3b2
    automated match to d1mqkl_
    complexed with ca, cu1, hea, lda, lmt, mn, peo

Details for d3hb3d_

PDB Entry: 3hb3 (more details), 2.25 Å

PDB Description: High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase
PDB Compounds: (D:) antibody fv fragment

SCOPe Domain Sequences for d3hb3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hb3d_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleik

SCOPe Domain Coordinates for d3hb3d_ are not available.

Timeline for d3hb3d_:

Domains from other chains:
(mouse over for more information)
d3hb3a_, d3hb3b1, d3hb3b2, d3hb3c_