SCOPe 2.08: Domain d3hb3c_: 3hb3 C:

Lineage for d3hb3c_ (3hb3 C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d3hb3c_: 3hb3 C: [177355]
   Other proteins in same PDB: d3hb3a_, d3hb3b1, d3hb3b2
   automated match to d1mqkh_
   complexed with ca, cu1, hea, lda, lmt, mn, peo

Details for d3hb3c_

PDB Entry: 3hb3, 2.25 Å

PDB Description: High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase

PDB Compounds: (C:) antibody fv fragment

SCOPe Domain Sequences for d3hb3c_:

Sequence; same for both SEQRES and ATOM records:

>d3hb3c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvss

Timeline for d3hb3c_:

• d3hb3c_ first appeared in SCOPe 2.01
  
• d3hb3c_ appears in SCOPe 2.07