Lineage for d1byed1 (1bye D:81-213)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538647Protein Class phi GST [81356] (3 species)
  7. 538648Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries)
  8. 538654Domain d1byed1: 1bye D:81-213 [17735]
    Other proteins in same PDB: d1byea2, d1byeb2, d1byec2, d1byed2
    complexed with ata

Details for d1byed1

PDB Entry: 1bye (more details), 2.8 Å

PDB Description: glutathione s-transferase i from mais in complex with atrazine glutathione conjugate

SCOP Domain Sequences for d1byed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byed1 a.45.1.1 (D:81-213) Class phi GST {Maize (Zea mays), type I}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalmkpsa

SCOP Domain Coordinates for d1byed1:

Click to download the PDB-style file with coordinates for d1byed1.
(The format of our PDB-style files is described here.)

Timeline for d1byed1: