Lineage for d1axdb1 (1axd B:81-210)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3847Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries)
  8. 3849Domain d1axdb1: 1axd B:81-210 [17731]
    Other proteins in same PDB: d1axda2, d1axdb2

Details for d1axdb1

PDB Entry: 1axd (more details), 2.5 Å

PDB Description: structure of glutathione s-transferase-i bound with the ligand lactoylglutathione
PDB Compounds: (B:)

SCOP Domain Sequences for d1axdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axdb1 a.45.1.1 (B:81-210) Glutathione S-transferase {Maize (Zea mays), type I}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalm

SCOP Domain Coordinates for d1axdb1:

Click to download the PDB-style file with coordinates for d1axdb1.
(The format of our PDB-style files is described here.)

Timeline for d1axdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axdb2