Class a: All alpha proteins [46456] (285 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class phi GST [81356] (3 species) |
Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries) |
Domain d1axda1: 1axd A:81-210 [17730] Other proteins in same PDB: d1axda2, d1axdb2 |
PDB Entry: 1axd (more details), 2.5 Å
SCOPe Domain Sequences for d1axda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp svqkvaalm
Timeline for d1axda1: