SCOP 1.67: Domain d1axda1: 1axd A:81-210

Lineage for d1axda1 (1axd A:81-210)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class phi GST [81356] (3 species)

7. Species Maize (Zea mays), type I [TaxId:4577] [47636] (2 PDB entries)

8. Domain d1axda1: 1axd A:81-210 [17730]
   Other proteins in same PDB: d1axda2, d1axdb2

Details for d1axda1

PDB Entry: 1axd, 2.5 Å

PDB Description: structure of glutathione s-transferase-i bound with the ligand lactoylglutathione

SCOP Domain Sequences for d1axda1:

Sequence; same for both SEQRES and ATOM records:

>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I}
ellregnleeaamvdvwieveanqytaalnpilfqvlispmlggttdqkvvdenleklkk
vlevyearltkckylagdflsladlnhvsvtlclfatpyasvldayphvkawwsglmerp
svqkvaalm

Timeline for d1axda1:

• d1axda1 first appeared (with stable ids) in SCOP 1.55
  
• d1axda1 appears in SCOP 1.65
  
• d1axda1 appears in SCOP 1.69
  
• d1axda1 appears in the current release, SCOPe 2.08