Lineage for d1bx9a1 (1bx9 A:86-210)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213854Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 213855Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 213856Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 214024Protein Class phi GST [81356] (3 species)
  7. 214034Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [47635] (2 PDB entries)
  8. 214037Domain d1bx9a1: 1bx9 A:86-210 [17729]
    Other proteins in same PDB: d1bx9a2
    complexed with foe

Details for d1bx9a1

PDB Entry: 1bx9 (more details), 2.6 Å

PDB Description: glutathione s-transferase in complex with herbicide

SCOP Domain Sequences for d1bx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx9a1 a.45.1.1 (A:86-210) Class phi GST {Mouse-ear cress (Arabidopsis thaliana)}
qtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklakv
ldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrpa
sekvq

SCOP Domain Coordinates for d1bx9a1:

Click to download the PDB-style file with coordinates for d1bx9a1.
(The format of our PDB-style files is described here.)

Timeline for d1bx9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bx9a2