Lineage for d1gnwb1 (1gnw B:86-211)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153284Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [47635] (2 PDB entries)
  8. 153286Domain d1gnwb1: 1gnw B:86-211 [17728]
    Other proteins in same PDB: d1gnwa2, d1gnwb2

Details for d1gnwb1

PDB Entry: 1gnw (more details), 2.2 Å

PDB Description: structure of glutathione s-transferase

SCOP Domain Sequences for d1gnwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnwb1 a.45.1.1 (B:86-211) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana)}
lqtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklak
vldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrp
asekvq

SCOP Domain Coordinates for d1gnwb1:

Click to download the PDB-style file with coordinates for d1gnwb1.
(The format of our PDB-style files is described here.)

Timeline for d1gnwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gnwb2