![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (8 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [187707] (9 PDB entries) |
![]() | Domain d3h6id_: 3h6i D: [177261] automated match to d1q5qa_ complexed with dmf |
PDB Entry: 3h6i (more details), 2.43 Å
SCOPe Domain Sequences for d3h6id_:
Sequence, based on SEQRES records: (download)
>d3h6id_ d.153.1.4 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal ragsadtsggdqptlgvaslevavldanrprrafrritgsalqall
>d3h6id_ d.153.1.4 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} peqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagkf nefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaeva hygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaal ragvaslevavldanrprrafrritgsalqall
Timeline for d3h6id_:
![]() Domains from other chains: (mouse over for more information) d3h6i1_, d3h6i2_, d3h6ia_, d3h6ib_, d3h6ic_, d3h6ie_, d3h6if_, d3h6ig_, d3h6ih_, d3h6ii_, d3h6ij_, d3h6ik_, d3h6il_, d3h6im_, d3h6in_, d3h6io_, d3h6ip_, d3h6iq_, d3h6ir_, d3h6is_, d3h6it_, d3h6iu_, d3h6iv_, d3h6iw_, d3h6ix_, d3h6iy_, d3h6iz_ |