Lineage for d1fhe_1 (1fhe 81-214)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153092Species Fasciola hepatica [TaxId:6192] [47634] (2 PDB entries)
  8. 153095Domain d1fhe_1: 1fhe 81-214 [17726]
    Other proteins in same PDB: d1fhe_2

Details for d1fhe_1

PDB Entry: 1fhe (more details), 3 Å

PDB Description: glutathione transferase (fh47) from fasciola hepatica

SCOP Domain Sequences for d1fhe_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhe_1 a.45.1.1 (81-214) Glutathione S-transferase {Fasciola hepatica}
lgttpeerarismiegaamdlrigfgrvcynpkfeevkeeyvkelpktlkmwsdflgdrh
yltgssvshvdfmlyetldsirylaphcldefpklkefksriealpkikaymeskrfikw
plngwaasfgagda

SCOP Domain Coordinates for d1fhe_1:

Click to download the PDB-style file with coordinates for d1fhe_1.
(The format of our PDB-style files is described here.)

Timeline for d1fhe_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fhe_2