Lineage for d3h6fp_ (3h6f P:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1223777Protein automated matches [190144] (8 species)
    not a true protein
  7. 1223908Species Mycobacterium tuberculosis [TaxId:1773] [187707] (9 PDB entries)
  8. 1224038Domain d3h6fp_: 3h6f P: [177245]
    automated match to d1q5qh_
    complexed with dmf

Details for d3h6fp_

PDB Entry: 3h6f (more details), 2.51 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome Modified by inhibitor HT1171
PDB Compounds: (P:) Proteasome (Beta subunit) PrcB

SCOPe Domain Sequences for d3h6fp_:

Sequence, based on SEQRES records: (download)

>d3h6fp_ d.153.1.4 (P:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs

Sequence, based on observed residues (ATOM records): (download)

>d3h6fp_ d.153.1.4 (P:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa
ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl
vrgifptaviidadgavdvpesriaelaraiiesrs

SCOPe Domain Coordinates for d3h6fp_:

Click to download the PDB-style file with coordinates for d3h6fp_.
(The format of our PDB-style files is described here.)

Timeline for d3h6fp_: