Lineage for d2fhea1 (2fhe A:81-216)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270526Protein Class alpha GST [81349] (8 species)
  7. 1270537Species Fasciola hepatica [TaxId:6192] [47634] (2 PDB entries)
  8. 1270538Domain d2fhea1: 2fhe A:81-216 [17724]
    Other proteins in same PDB: d2fhea2, d2fheb2
    complexed with gsh

Details for d2fhea1

PDB Entry: 2fhe (more details), 2.3 Å

PDB Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2fhea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]}
igttseerarvsmiegaavdlrqgisrisyqpkfeqlkegylkdlpttmkmwsdflgknp
ylrgtsvshvdfmvyealdairylephcldhfpnlqqfmsriealpsikaymesnrfikw
plngwhaqfgggdapp

SCOPe Domain Coordinates for d2fhea1:

Click to download the PDB-style file with coordinates for d2fhea1.
(The format of our PDB-style files is described here.)

Timeline for d2fhea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fhea2