Lineage for d2fhea1 (2fhe A:81-216)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153092Species Fasciola hepatica [TaxId:6192] [47634] (2 PDB entries)
  8. 153093Domain d2fhea1: 2fhe A:81-216 [17724]
    Other proteins in same PDB: d2fhea2, d2fheb2

Details for d2fhea1

PDB Entry: 2fhe (more details), 2.3 Å

PDB Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione

SCOP Domain Sequences for d2fhea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhea1 a.45.1.1 (A:81-216) Glutathione S-transferase {Fasciola hepatica}
igttseerarvsmiegaavdlrqgisrisyqpkfeqlkegylkdlpttmkmwsdflgknp
ylrgtsvshvdfmvyealdairylephcldhfpnlqqfmsriealpsikaymesnrfikw
plngwhaqfgggdapp

SCOP Domain Coordinates for d2fhea1:

Click to download the PDB-style file with coordinates for d2fhea1.
(The format of our PDB-style files is described here.)

Timeline for d2fhea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fhea2