SCOP 1.55: Domain d2fhea1: 2fhe A:81-216

Lineage for d2fhea1 (2fhe A:81-216)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)

6. Protein Glutathione S-transferase [47618] (22 species)

7. Species Fasciola hepatica [TaxId:6192] [47634] (2 PDB entries)

8. Domain d2fhea1: 2fhe A:81-216 [17724]
   Other proteins in same PDB: d2fhea2, d2fheb2

Details for d2fhea1

PDB Entry: 2fhe, 2.3 Å

PDB Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione

SCOP Domain Sequences for d2fhea1:

Sequence; same for both SEQRES and ATOM records:

>d2fhea1 a.45.1.1 (A:81-216) Glutathione S-transferase {Fasciola hepatica}
igttseerarvsmiegaavdlrqgisrisyqpkfeqlkegylkdlpttmkmwsdflgknp
ylrgtsvshvdfmvyealdairylephcldhfpnlqqfmsriealpsikaymesnrfikw
plngwhaqfgggdapp

Timeline for d2fhea1:

• d2fhea1 appears in SCOP 1.57
  
• d2fhea1 appears in the current release, SCOPe 2.08