Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [187707] (9 PDB entries) |
Domain d3h6fg_: 3h6f G: [177236] automated match to d1q5qh_ complexed with dmf |
PDB Entry: 3h6f (more details), 2.51 Å
SCOPe Domain Sequences for d3h6fg_:
Sequence, based on SEQRES records: (download)
>d3h6fg_ d.153.1.4 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
>d3h6fg_ d.153.1.4 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} xtivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya velehyeklegvpltfagkinrlaimvrgnlalalpllagydihasdpqsagrivsfdaa ggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsatggpdl vrgifptaviidadgavdvpesriaelaraiiesrs
Timeline for d3h6fg_:
View in 3D Domains from other chains: (mouse over for more information) d3h6f1_, d3h6f2_, d3h6fa_, d3h6fb_, d3h6fc_, d3h6fd_, d3h6fe_, d3h6ff_, d3h6fh_, d3h6fi_, d3h6fj_, d3h6fk_, d3h6fl_, d3h6fm_, d3h6fn_, d3h6fo_, d3h6fp_, d3h6fq_, d3h6fr_, d3h6fs_, d3h6ft_, d3h6fu_, d3h6fv_, d3h6fw_, d3h6fx_, d3h6fy_, d3h6fz_ |