Lineage for d1gtb_1 (1gtb 81-218)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 153066Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 153067Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 153068Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 153080Protein Glutathione S-transferase [47618] (27 species)
  7. 153342Species Schistosoma japonicum [TaxId:6182] [47633] (5 PDB entries)
  8. 153347Domain d1gtb_1: 1gtb 81-218 [17722]
    Other proteins in same PDB: d1gtb_2

Details for d1gtb_1

PDB Entry: 1gtb (more details), 2.6 Å

PDB Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel

SCOP Domain Sequences for d1gtb_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtb_1 a.45.1.1 (81-218) Glutathione S-transferase {Schistosoma japonicum}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppk

SCOP Domain Coordinates for d1gtb_1:

Click to download the PDB-style file with coordinates for d1gtb_1.
(The format of our PDB-style files is described here.)

Timeline for d1gtb_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gtb_2